PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B02480.1.p
Common NameEUGRSUZ_B02480, LOC104432854
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ARF
Protein Properties Length: 798aa    MW: 88532.8 Da    PI: 6.7513
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B02480.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.82.3e-24169270199
                       EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                       f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + 
  Eucgr.B02480.1.p 169 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyK-QQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSVFVSQKNLVSGDAVLFL--RG 258
                       99****************************963.3445679************************************************..44 PP

                       SEE..EEEEE-S CS
                B3  88 sefelvvkvfrk 99 
                       +++el+++++r+
  Eucgr.B02480.1.p 259 EDGELRLGIRRA 270
                       9999*****996 PP

2Auxin_resp115.25.6e-38295376182
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                       +a+a+stksvF+v+Y+Pras++eFvv+++k++k++++ +++G+Rfkm+++ +d++e+r++G+v+ + dldp+rWpnSkWr+L
  Eucgr.B02480.1.p 295 VASAVSTKSVFHVFYSPRASHAEFVVPYQKYLKSINNVICIGTRFKMRVDVDDAPEKRCTGVVTRIGDLDPYRWPNSKWRCL 376
                       6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.0E-41161278IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-45162286IPR015300DNA-binding pseudobarrel domain
CDDcd100176.60E-23167269No hitNo description
PfamPF023621.7E-22169270IPR003340B3 DNA binding domain
PROSITE profilePS5086313.197169271IPR003340B3 DNA binding domain
SMARTSM010191.8E-23169271IPR003340B3 DNA binding domain
PfamPF065071.9E-32296376IPR010525Auxin response factor
PfamPF023095.1E-8666754IPR033389AUX/IAA domain
SuperFamilySSF542772.03E-9667748No hitNo description
PROSITE profilePS5174520.28669751IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 798 aa     Download sequence    Send to blast
MEIDLNHAVS DVENASNACC DGHCEKGNGC LHCLSSTSSN SSSSSSSSAV PCSIYSELWH  60
ACAGRLTSLP KKGNVVLYFP QGHLEQVASA SPYSPMEMPT FDLQPQIFCR VVNVQLLANK  120
DNDEVYTKVT LLPQLELVGL DSEGRALEEL GVDENDIGGS PPRSTPHMFC KTLTASDTST  180
HGGFSVPRRA AEDCFPPLDY KQQRPSQELV AKDLHGVEWR FRHIYRGQPR RHLLTTGWSV  240
FVSQKNLVSG DAVLFLRGED GELRLGIRRA HRPRNVLPGS TVGEQNMCPA VLSAVASAVS  300
TKSVFHVFYS PRASHAEFVV PYQKYLKSIN NVICIGTRFK MRVDVDDAPE KRCTGVVTRI  360
GDLDPYRWPN SKWRCLMVQW DDDITNGHQD RVSPWEIDPS VSHSPLSIQS SPRLKRPRTS  420
LPTMPPVPGG GVRLLDFEES LRSSKVLQGQ EKLHLVSPVY GRDTLNCQVD FEQSPAHQGL  480
ASVVVEKANN INEYMRANAP SYAGFVESDR FPRVLQGQEI CTLKSLTTKP EYNLGTWGKS  540
SLSCSSFGVH QAPKYHFDQV KSSESLQKVY FPYNDILKSS QDRTRCSDST NFLREVASVR  600
SLRVQNEAIE RTKVDVRNLE SICTSPNFGD SQRAQANGSI DSLLSGCKLF GYPLTAEAPT  660
STLQNSGKRS CTKVHKQGNL VGRAIDLSRL NSYQDLLNDL ERLFSMEGLL RDHDKGWRIL  720
YTDSENDVMV LGDIPWHEFC DVVTKIHIYT QEEVEKMTTG MISDDTQSCL DQAPLMMEAS  780
KSSSVGQPDG SPTVVRL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-120384043359Auxin response factor 1
4ldy_B1e-120384043359Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B02480.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010043718.10.0PREDICTED: auxin response factor 4
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLA0A059D5410.0A0A059D541_EUCGR; Auxin response factor
STRINGXP_010043718.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4
Publications ? help Back to Top
  1. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  3. Pashkovskiy PP,Kartashov AV,Zlobin IE,Pogosyan SI,Kuznetsov VV
    Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.
    Plant Physiol. Biochem., 2016. 104: p. 146-54
    [PMID:27031426]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  6. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]