PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B01031.1.p
Common NameEUGRSUZ_B01031, LOC104423912
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family CPP
Protein Properties Length: 794aa    MW: 86809.8 Da    PI: 5.1453
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B01031.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.83.3e-16496534240
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       ++k+CnCkkskClk+YCeCfaag++C e C C+dC+Nk 
  Eucgr.B01031.1.p 496 TCKRCNCKKSKCLKLYCECFAAGVYCIEPCACQDCFNKP 534
                       689**********************************96 PP

2TCR50.44.5e-16581619139
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                       ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Eucgr.B01031.1.p 581 RHKRGCNCKKSSCLKKYCECYQGGVGCSINCRCEGCKNA 619
                       589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.2E-18495536IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.799496621IPR005172CRC domain
PfamPF036381.2E-11498533IPR005172CRC domain
SMARTSM011141.0E-16581622IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-11583619IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MDTPERNQIA APISKFEDSP VFNYINSLSP IKPVKSIRIT QAFSSLTFGS LPSIFTSPHV  60
SSSHKESRFL RSHQDSDPSN IGTSCKDENK IPTAECDVSD VAQLAENESE LQENFDILVP  120
IGESSVEPLD EHQEFALDLP QSLKYDCGSP NSDPTPCSTA ADCTVSKSDA PVDEKNSQID  180
LPDGRSHQEG TSQQKNDTGC GWESLALEST DLLIFSSPND AAAFRGLIQR SPDVEVGYFT  240
SMVSNFPENE VSEELKSHLL YQLTFNEQHE AEEPSCQPVD PSEQKDTNTL PNGVAISNLD  300
NHTGTYLSVN MDNEVGAHIP FANKPISDLP RGMRRRCLDF EMVGTQQKSL DGGSGGISSP  360
LLKSDENDIP KNKQLVVVKG GGDSSRCIVP GIGLHLNALT STTKDSRIVK HESLLSDVQA  420
LNVHMSTTSL QSPLTNQESL HKSLTLSNAE EMDHDNGLQV AEEVSQAPTD LNYEENGQTS  480
PRKKRRRMEN GGESETCKRC NCKKSKCLKL YCECFAAGVY CIEPCACQDC FNKPIHEDTV  540
LATRKQIESR NPLAFAPKVI RSSESASEYG EDSSKTPASA RHKRGCNCKK SSCLKKYCEC  600
YQGGVGCSIN CRCEGCKNAF GTKDGSALRG PDCEEEEETE KCEKNKAEKI PWKMENENND  660
ELNLASALPS TPSGFRRPLV QLAFPSKLKQ PRSSFVTIGS SYALHSSQKM GKPDLLLPPP  720
PKFEKLPLTN MEDEIPEILC SSSTPTASIK STSPNSKRVS PPHSDFGTSP NLRSGRRLIL  780
QSIPSFPSLT PQH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1750061814120Protein lin-54 homolog
5fd3_B1e-1750061814120Protein lin-54 homolog
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B01031.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2175865e-50AC217586.1 Populus trichocarpa clone POP025-M11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010034650.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLA0A059D0A80.0A0A059D0A8_EUCGR; Uncharacterized protein
STRINGXP_010034650.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-162TESMIN/TSO1-like CXC 2