PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A02588.1.p
Common NameEUGRSUZ_A02588, LOC104446987
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 704aa    MW: 75387.1 Da    PI: 8.3834
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A02588.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.6e-093914281954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Eucgr.A02588.1.p 391 FEHflHPYPKDSDKVMLAKQTGLTRSQVSNWFINARVR 428
                       664459******************************88 PP

2BELL123.77.5e-40255326172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       erqe+q+kkakL+++l+eV++rY+qy++q+q+vissFe++ag+gsa+ Yt+lAl++iS++FrcLkdaia+qi
  Eucgr.A02588.1.p 255 ERQEIQMKKAKLINMLDEVEQRYRQYHNQMQIVISSFEQAAGIGSARTYTALALQTISKQFRCLKDAIAGQI 326
                       79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-63184324IPR006563POX domain
PfamPF075266.3E-49189323IPR006563POX domain
PROSITE profilePS5007112.228369432IPR001356Homeobox domain
SMARTSM003892.2E-9372436IPR001356Homeobox domain
CDDcd000861.04E-12372433No hitNo description
SuperFamilySSF466894.71E-17373439IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28375438IPR009057Homeodomain-like
PfamPF059204.8E-18389428IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MATYYHQSSS DPDGALQTLV LMNPASYVHY SDAPPPHQQP SAIFLNSSTA GPPASQTQQF  60
VGIPLPGSAA DSQPSSMHVN HDLSSMHGFM PRVQYNLWSS LDPSTAAREA SRTHQQQGLS  120
LSLSPQQPPP TPAGYRSFVR AERSGDGAAG SQHPPAISGG EDVRISGGSP SSASGVTNGA  180
AVGSGMQGVL LSSKYLKAAQ ELLEEVVNVG NTGIKAEMLK KASGQSKPGG ESAALKEEGG  240
GDGSGKRGAE LSMAERQEIQ MKKAKLINML DEVEQRYRQY HNQMQIVISS FEQAAGIGSA  300
RTYTALALQT ISKQFRCLKD AIAGQIRAAN KSLGEEDGPG GKIEGSRLKF VDHHLRQQRA  360
LQQLGMIQQN AWRPQRGLPE RSVSILRAWL FEHFLHPYPK DSDKVMLAKQ TGLTRSQVSN  420
WFINARVRLW KPMVEEMYTE EIKEQEQNGG GAEEKPSKSE REDSASKSSG LQDKAPNSNE  480
NSTKSFKPKE ITSRNHDTPA ISTNSASSIG GNVRSSSSGF TLVGPSELEG LTQGSPKKPR  540
SAELLQNLSN VSSLNVNPKL GEAISMKFID EGQGRDGYPI IGGGPANFIG GFGQYPMGEI  600
GRFGADQFAP SFSGNGVSPT FSGNGVSLTL GLPHSENLSL SGAHQSFLPS QNIQLGRRVD  660
IGEANEFGAM NTPTIPHSSS AYETMNIQNR KRFPVQLLQD FVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16378435158Homeobox protein Meis1
4xrs_B2e-16378435158Homeobox protein Meis1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A02588.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059079.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A059DJ990.0A0A059DJ99_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s21950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-162BEL1-like homeodomain 1