PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A02570.1.p
Common NameEUGRSUZ_A02570, LOC104446863
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YA
Protein Properties Length: 326aa    MW: 35337.4 Da    PI: 9.2803
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A02570.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA92.93.8e-29158213158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       d p++VNaKQy++I++RR+ Rak+  e+k+  + rkpy+heSRh hA+rRpRg+gGrF
  Eucgr.A02570.1.p 158 DGPIFVNAKQYHAIIRRRKFRAKAVLENKV--TRRKPYMHESRHLHAMRRPRGCGGRF 213
                       57****************************..99***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.3E-31156216IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115233.024157216IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.5E-21160182IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.0E-24160213IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.5E-21190213IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MAMQALYLKE HEGMLHNPTS QLSSAPSAAP WWAAFGSQSF HGDSLGQSNS SPVDNPSCGD  60
HLTPAKQAGR GTEQGADKGS LTQFTIFSGD YKNSANTQKS QLPISPLPEY CARVDLGYGQ  120
QMICAKYPYG EQCYGVFSPF GSQISGRMML PLNLSTDDGP IFVNAKQYHA IIRRRKFRAK  180
AVLENKVTRR KPYMHESRHL HAMRRPRGCG GRFLNVRNSS NEEGGAEAKK DSGGEFPQPT  240
GSQSSDLSQS ESGTTPSLPK EANGSAGNLS GSEVTSMYSR EGLGRFPINQ LGPSYSFTSM  300
NDTSHSIVMP SKWVAAVDNR RNLNV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A2e-15158214260HAPB protein
4g91_A2e-15158214260HAPB protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1173190RRKFRAKAVLENKVTRRK
2174191RKFRAKAVLENKVTRRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A02570.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010058967.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1
TrEMBLA0A059DJ720.0A0A059DJ72_EUCGR; Uncharacterized protein
STRINGVIT_08s0032g01190.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30082767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.17e-38nuclear factor Y, subunit A2