PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A02381.1.p
Common NameEUGRSUZ_A02381, LOC104445232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YA
Protein Properties Length: 304aa    MW: 33437.2 Da    PI: 9.8118
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A02381.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.51.6e-31169225158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep+YVNaKQy++Il+RRq+Rak+e  +kl +++rkpylheSRh hA+rR+Rg+gGrF
  Eucgr.A02381.1.p 169 EEPVYVNAKQYNGILRRRQSRAKAELARKL-IRERKPYLHESRHLHAMRRARGCGGRF 225
                       69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.9E-36167228IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.009168228IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.8E-27170225IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.8E-23171193IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860173193IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.8E-23202225IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGRNMNNKLE VNPYANGGGV HPFYSHKKHH ATIVDMLKSL DDQPTGNNSD RALGTKIIGL  60
RSTGAPEVNG VHQHRHHAEV SQSGAAMAEL FKQEQRRSTE GVSILLPTST DYATAPSQQV  120
CHPIACGSYE YSEQYHDEVK PAYGPQISAH SQYLGYNSLR LGLPLRVAEE PVYVNAKQYN  180
GILRRRQSRA KAELARKLIR ERKPYLHESR HLHAMRRARG CGGRFLNTKK QDNAATDPTP  240
EGSISSDSRS TGSARESYLS SSKLATSALS LNEDPSTSLI SKENVPRAQN ALHTWANHSG  300
NYA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-20169238272NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A02381.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010057360.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like
TrEMBLA0A059DIJ00.0A0A059DIJ0_EUCGR; Uncharacterized protein
STRINGVIT_08s0007g08250.t013e-56(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156021015
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.31e-37nuclear factor Y, subunit A1