PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS785390.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 111aa    MW: 12455.7 Da    PI: 10.2482
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS785390.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.36.6e-26958150
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                  krien   rqvtf+kRr+g+lKKA+ELSvLCda++ + ifs++gklye +
  EcS785390.10  9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDADIGLFIFSPHGKLYELA 58
                  79*********************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.2E-36160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-29176IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.492161IPR002100Transcription factor, MADS-box
CDDcd002653.91E-41278No hitNo description
PRINTSPR004043.7E-27323IPR002100Transcription factor, MADS-box
PfamPF003198.2E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD ADIGLFIFSP HGKLYELATK  60
GTMKGLIERY MKTTQSQAAL TEEATPSQPL DAKEEINILK QEIEALRKGL G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-16167167MEF2C
5f28_B3e-16167167MEF2C
5f28_C3e-16167167MEF2C
5f28_D3e-16167167MEF2C
6byy_A4e-16167167MEF2 CHIMERA
6byy_B4e-16167167MEF2 CHIMERA
6byy_C4e-16167167MEF2 CHIMERA
6byy_D4e-16167167MEF2 CHIMERA
6bz1_A4e-16167167MEF2 CHIMERA
6bz1_B4e-16167167MEF2 CHIMERA
6bz1_C4e-16167167MEF2 CHIMERA
6bz1_D4e-16167167MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062376.13e-76PREDICTED: agamous-like MADS-box protein AGL12
SwissprotQ388411e-50AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLA0A059BU686e-75A0A059BU68_EUCGR; Uncharacterized protein
STRINGXP_010062376.11e-75(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.16e-53AGAMOUS-like 12
Publications ? help Back to Top
  1. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  2. Pacheco-Escobedo MA, et al.
    Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm.
    Ann. Bot., 2018.
    [PMID:27358290]
  3. GarcĂ­a-Cruz KV, et al.
    The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components.
    Ann. Bot., 2018.
    [PMID:27474508]