PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS781666.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 128aa    MW: 13449.4 Da    PI: 8.8606
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS781666.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY53.54.8e-176471859
                  -SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY 18 sefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                  s + r+YYrCtsagCpv+k++e++ ++ ++v+itY+g H+h+
  EcS781666.10  6 SANFRNYYRCTSAGCPVRKQIETAVDNANAVIITYKGVHDHD 47
                  6678*************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081117.832149IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-15649IPR003657WRKY domain
SMARTSM007741.2E-8648IPR003657WRKY domain
PfamPF031062.5E-11746IPR003657WRKY domain
SuperFamilySSF1182905.75E-14749IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MAFMMSANFR NYYRCTSAGC PVRKQIETAV DNANAVIITY KGVHDHDMPV PKKRHGPPSA  60
PLVAAAAPAS MSSAQNKKVD AAQNGKASTK LSVDAGGELT GEAMELGGEK AMESARTLLS  120
IGIEIKPC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048803.12e-77PREDICTED: probable WRKY transcription factor 32 isoform X1
SwissprotP595834e-48WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A059CRS33e-77A0A059CRS3_EUCGR; Uncharacterized protein
STRINGPGSC0003DMT4000290699e-62(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.12e-38WRKY DNA-binding protein 32