PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS763394.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 120aa    MW: 13793.7 Da    PI: 9.5232
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS763394.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260108.26.3e-3415111197
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   aCa+Ck++r+kC ++Cvl+pyfpae++ +f++vh ++G+snv+k++ a++e++r+ +++sl++eA+ r++dPv+Ga++ ++++q++l+  k+ l+++
  EcS763394.10  15 ACASCKHQRKKCDEKCVLSPYFPAEKSVEFQAVHGVYGVSNVTKMVLAVREQDRRWVADSLIWEARHRQQDPVHGAFAEYQRIQNELQYYKSLLQKQ 111
                   7**************************************************************************************9999877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.4414115IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-3215109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MHRPINNGIG GTHAACASCK HQRKKCDEKC VLSPYFPAEK SVEFQAVHGV YGVSNVTKMV  60
LAVREQDRRW VADSLIWEAR HRQQDPVHGA FAEYQRIQNE LQYYKSLLQK QAIQSQRLQG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010038683.13e-85PREDICTED: LOB domain-containing protein 12
SwissprotQ9LNB91e-43LBD2_ARATH; LOB domain-containing protein 2
TrEMBLB9SGN17e-43B9SGN1_RICCO; LOB, putative
STRINGscaffold_100624.11e-41(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.16e-45LOB domain-containing protein 2