PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS755020.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family CPP
Protein Properties Length: 411aa    MW: 43669.8 Da    PI: 6.5817
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS755020.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.91.5e-161049140
           TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40
                  k++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dCkN e
  EcS755020.10 10 KHNKGCHCKKSGCLKKYCECFQANILCSENCRCMDCKNFE 49
                  589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163419.866150IPR005172CRC domain
SMARTSM011141.0E-191051IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.7E-131348IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MQEDAGALGK HNKGCHCKKS GCLKKYCECF QANILCSENC RCMDCKNFEG SEERQALFHG  60
DHANNMAYIQ QAANAAITGA VGSSGFASPP LSKKKKGQEL FFGSNSTVKD PSIQRLGQFP  120
QPNNTKATAP FSLSSAPVTH GVSNTLSAPS KCTYRSLLAD IIQPQDVKEL CSVLVVLSGE  180
VAKTLAEEKN AKEKQVADQT EASLASSTQD RTQSLKNPDG GKTAADNCSS SSQVDKSGHE  240
ESVSDSAEAP NGRPVSPGTL ALMCDEQDTM FMAAASPSGL MGHDCNSSSQ VSHGQGITEV  300
YAEQERIVLA KVRDCLNKLI TFGEIKETKY SSLARTELGL QKDPICNGGA NGKIDTGHQP  360
WLESNSIGRT SVPPPLSTQV VSTAVSTSRT DNSNMSRALE NGSIQPKVEQ I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-15105983132Protein lin-54 homolog
5fd3_B7e-15105983132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010050570.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD11e-131TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A059CP020.0A0A059CP02_EUCGR; Uncharacterized protein
STRINGXP_010050570.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-133Tesmin/TSO1-like CXC domain-containing protein