PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS746304.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 70aa    MW: 7663.72 Da    PI: 10.1179
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS746304.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like54.23.2e-173270139
       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvk 39
                  k r+rWt+ LH++F+e+v++LGG+e A Pk il+lm+v+
  EcS746304.10 32 KRRIRWTQHLHNQFLECVNRLGGAETAKPKLILKLMDVE 70
                  68***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.56E-72969IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-143070IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-113270IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
LEKGPPVSRN EAKPDADPGG NSNSLAAATS SKRRIRWTQH LHNQFLECVN RLGGAETAKP  60
KLILKLMDVE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007028968.13e-16Myb-like HTH transcriptional regulator family protein, putative isoform 2
TrEMBLA0A061EWJ53e-16A0A061EWJ5_THECC; Myb-like HTH transcriptional regulator family protein, putative isoform 2
STRINGGLYMA09G17404.12e-14(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1952777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.24e-14G2-like family protein