PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS720831.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 104aa    MW: 11832 Da    PI: 5.6262
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS720831.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof86.42.7e-2763104243
        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkG 43 
                   ++k+++cprC+s++tkfCyynny+++qPr+fC+aC+ryWt+G
  EcS720831.10  63 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCRACQRYWTAG 104
                   7899************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2251104IPR003851Zinc finger, Dof-type
PfamPF027011.2E-2265104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088423.12367104IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MQEEDEPPPN SQELDPSRTS PDAVNPMTPS IQEESTTSHI TETGAQEEHG TPKNSQGKTL  60
KKPDKIIPCP RCNSMDTKFC YYNNYNVNQP RHFCRACQRY WTAG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037174.13e-67PREDICTED: cyclic dof factor 3-like isoform X2
SwissprotQ93ZL53e-30CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A059A6744e-67A0A059A674_EUCGR; Uncharacterized protein
STRINGGLYMA05G00970.14e-38(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-31cycling DOF factor 2