PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS720455.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 143aa    MW: 16283.2 Da    PI: 4.8044
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS720455.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26054.82.8e-17278344100
        DUF260  44 kllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                   +  ++lpe++r+da++s++yeA  r+rdPvyG++g i++lq q+++l+a+la+ ++e
  EcS720455.10  27 RNFQTLPESQRDDAVTSMIYEASTRIRDPVYGCAGAISQLQMQISHLHAQLAKSQAE 83 
                   667899**********************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.647184IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-152881IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
FGHALNCHFA SHYLYEEQLI DGGMTFRNFQ TLPESQRDDA VTSMIYEAST RIRDPVYGCA  60
GAISQLQMQI SHLHAQLAKS QAELISMQIQ RANLTEQLQM TKSQESLPQL SVKGLLNNPY  120
DYQINSCLDD YNGFGSFWDP LWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056894.12e-79PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR06e-30LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK082e-29LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A061GTD12e-38A0A061GTD1_THECC; LOB domain-containing protein 1
STRINGPOPTR_0008s04350.12e-34(Populus trichocarpa)
STRINGPOPTR_0010s22470.12e-34(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-31LOB domain-containing protein 1