PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS719901.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GeBP
Protein Properties Length: 240aa    MW: 27042.7 Da    PI: 9.2927
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS719901.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573122.91.5e-387103197
        DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                   klfqr+w ++De++lLqG+idf++++g++p+++++af++fvkks+  ++++sql +Kir LKkK+ +++ k k+g++ sfsk+h+qk+felskkiWg
  EcS719901.10   7 KLFQRIWGDDDELALLQGMIDFRETKGMDPFANTNAFHHFVKKSLGQEFTHSQLANKIRVLKKKYSNNEGKGKDGEDRSFSKPHEQKVFELSKKIWG 103
                   579*********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.5E-329103IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
SGEESKKLFQ RIWGDDDELA LLQGMIDFRE TKGMDPFANT NAFHHFVKKS LGQEFTHSQL  60
ANKIRVLKKK YSNNEGKGKD GEDRSFSKPH EQKVFELSKK IWGANKSSDA GGSGEQTPMP  120
KANGTAKKSK AATAAKVPKL KMETSLERPK ENGELVLSEH IDAGSMLSCD YKMLQLSALG  180
LDQDFMKKGW EMLDQSRKEE LKERWMKVQL AEMRVLAERA TLISDQTNLV LEAYERANGN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052459.11e-159PREDICTED: mediator-associated protein 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.12e-34DNA-binding storekeeper protein-related transcriptional regulator