PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS671351.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 169aa    MW: 18955.7 Da    PI: 7.7498
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS671351.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.53.1e-171158249
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                  +i++ ++r +tfskRr+g++KKA+ L  L++a+ avi+fs+t+kly +
  EcS671351.10 11 KINDPIKRRITFSKRREGLFKKASVLGELTGARTAVIVFSTTDKLYSF 58
                  68999*****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-16261IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.282262IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-20374IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-14424IPR002100Transcription factor, MADS-box
PfamPF003193.7E-181158IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-142439IPR002100Transcription factor, MADS-box
PRINTSPR004046.8E-143960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MVRRRRKEIA KINDPIKRRI TFSKRREGLF KKASVLGELT GARTAVIVFS TTDKLYSFGD  60
PSVEEIVSDY LRCNGDVMPP TSVRGGSCVT EADFLSLIMK YEAVLNCVRK KLKDLENNPS  120
VKTDAGDDSG VRVGRDCEVL YDDEINSLLE SFEVPCPSLL THFENCARN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
127RRRRKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045944.11e-37PREDICTED: MADS-box protein SOC1-like
STRINGXP_010045609.12e-56(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-16AGAMOUS-like 61