PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS656811.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 55aa    MW: 6244.92 Da    PI: 5.6272
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS656811.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26032.42.6e-102514594
        DUF260 45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94
                  +l+++p+++r da++ lvyeA+ar +dPv+G  g + ++  + e+l++  
  EcS656811.10  2 ILQQVPNDRRADAIHRLVYEANARENDPVNGRRGQLAQMIAEEERLQVPH 51
                  799*********************************99999999888755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508918.55155IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-8249IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 55 aa     Download sequence    Send to blast
EILQQVPNDR RADAIHRLVY EANARENDPV NGRRGQLAQM IAEEERLQVP HQAAG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033333.12e-30PREDICTED: LOB domain-containing protein 12-like
TrEMBLA0A059AGU22e-30A0A059AGU2_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3507622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16530.12e-08ASYMMETRIC LEAVES 2-like 9