PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS647077.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 91aa    MW: 10511.3 Da    PI: 9.6171
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS647077.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.99.8e-322575151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krien++nrqvtf+kRrng+lKKA+ELSvLC+aeva+i+fss+g+lyey++
  EcS647077.10 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCEAEVALIVFSSRGRLYEYAN 75
                  79***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.9E-421776IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.5291777IPR002100Transcription factor, MADS-box
CDDcd002653.81E-401879No hitNo description
SuperFamilySSF554556.93E-301877IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-331939IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PfamPF003198.5E-272673IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-333954IPR002100Transcription factor, MADS-box
PRINTSPR004043.0E-335475IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MVFPTQATPE ESPQRKMGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCEAEVA  60
LIVFSSRGRL YEYANDRYLC SLLFGLFCLI S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-211779166Myocyte-specific enhancer factor 2B
1tqe_Q5e-211779166Myocyte-specific enhancer factor 2B
1tqe_R5e-211779166Myocyte-specific enhancer factor 2B
1tqe_S5e-211779166Myocyte-specific enhancer factor 2B
6c9l_A5e-211779166Myocyte-specific enhancer factor 2B
6c9l_B5e-211779166Myocyte-specific enhancer factor 2B
6c9l_C5e-211779166Myocyte-specific enhancer factor 2B
6c9l_D5e-211779166Myocyte-specific enhancer factor 2B
6c9l_E5e-211779166Myocyte-specific enhancer factor 2B
6c9l_F5e-211779166Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289652.11e-49glycogen debranching enzyme
RefseqXP_010057184.11e-49PREDICTED: glycogen debranching enzyme isoform X1
RefseqXP_010057185.11e-49PREDICTED: glycogen debranching enzyme isoform X2
RefseqXP_010057186.11e-49PREDICTED: glycogen debranching enzyme isoform X2
RefseqXP_018728407.11e-49PREDICTED: glycogen debranching enzyme isoform X1
SwissprotQ435851e-40AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBLA0A059C6W43e-48A0A059C6W4_EUCGR; Uncharacterized protein
TrEMBLC0STT03e-48C0STT0_EUCGR; Agamous-like protein
STRINGXP_010057183.15e-49(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.15e-39MIKC_MADS family protein
Publications ? help Back to Top
  1. Cheung AY,Zhan XY,Wang H,Wu HM
    Organ-specific and Agamous-regulated expression and glycosylation of a pollen tube growth-promoting protein.
    Proc. Natl. Acad. Sci. U.S.A., 1996. 93(9): p. 3853-8
    [PMID:8632979]