PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS601285.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 166aa    MW: 18354.8 Da    PI: 4.7245
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS601285.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.23.3e-161154245
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                  +i n   r vt+skRr+g++ KA+ L+ LC+a++av++fs+ g+
  EcS601285.10 11 KIVNPAARLVTYSKRRKGLFNKASQLCRLCGARAAVVVFSPAGE 54
                  5778889**********************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.39262IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-19261IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-21476IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-12424IPR002100Transcription factor, MADS-box
PfamPF003192.2E-191158IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-122439IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-123960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MGKRRRTEIS KIVNPAARLV TYSKRRKGLF NKASQLCRLC GARAAVVVFS PAGEPCSFGE  60
PSADEIIGDY LRHGDCDGDA TPPMGLTQWG DWMETEWEAC ATEEDLEALI LKYEAIRDCA  120
RRRLKSLEEA SRVEVGGGES RILSEEEIDA LFESLGRCPA LSDLLT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010046031.11e-110PREDICTED: protein MADS AFFECTING FLOWERING 5-like
TrEMBLA0A059D1D11e-113A0A059D1D1_EUCGR; Uncharacterized protein (Fragment)
STRINGXP_010046031.11e-110(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3499522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-19AGAMOUS-like 61