PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS596752.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 50aa    MW: 5627.67 Da    PI: 10.3793
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS596752.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26060.64.3e-191350138
        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFG 38
                  +CaaCk+lrr+Ca+dCv+apyfpa+qp+kfa+vhk+FG
  EcS596752.10 13 PCAACKLLRRRCARDCVFAPYFPADQPQKFAIVHKVFG 50
                  7************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.5211250IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-171350IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 50 aa     Download sequence    Send to blast
MKESGRKQGT LSPCAACKLL RRRCARDCVF APYFPADQPQ KFAIVHKVFG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064042.13e-31PREDICTED: LOB domain-containing protein 4-like isoform X1
SwissprotQ9SHE91e-26LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A059C0A23e-31A0A059C0A2_EUCGR; Uncharacterized protein
STRINGGLYMA08G17990.11e-27(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-14LOB domain-containing protein 4