PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS588623.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 101aa    MW: 11222.5 Da    PI: 7.0906
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS588623.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like53.36e-171302756
       G2-like 27 AtPktilelmkvkgLtlehvkSHLQkYRla 56
                  AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  EcS588623.10  1 ATPKQIRELMQVDGLTNDEVKSHLQKYRLH 30
                  9***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.36E-6133IPR009057Homeodomain-like
PROSITE profilePS5129411.013132IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-14133IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-13130IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
ATPKQIRELM QVDGLTNDEV KSHLQKYRLH NQRHPIKAFR SQKSGIQTVL EMATDISGDS  60
LKMTGPQSPS PQSSFHIAGN PGLTSHTASD SMEEDREPRD P
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028507.13e-66PREDICTED: uncharacterized protein LOC104418763
TrEMBLA0A059ANG45e-67A0A059ANG4_EUCGR; Uncharacterized protein
STRINGPOPTR_0004s15220.16e-21(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2069636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-16G2-like family protein