PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS581303.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 133aa    MW: 14564.6 Da    PI: 8.7892
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS581303.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF63.22.9e-20551551
                  SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  ++s  ++tf+kRrn ++KKA+ LS LCdaev +i+fs tg+lyeyss
  EcS581303.10  5 SSSSDHITFAKRRNWLMKKAKDLSQLCDAEVGIIVFSCTGQLYEYSS 51
                  678889***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.063153IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-11452IPR002100Transcription factor, MADS-box
PfamPF003191.1E-17649IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.05E-17753IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-131530IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-133051IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MNPHSSSSDH ITFAKRRNWL MKKAKDLSQL CDAEVGIIVF SCTGQLYEYS SSRSVCINRF  60
DSPCLPLPSS HMRARTPARA RTNHDTCACA SSSCSFGCHS GATFSSMSGL ISEMTTLLRL  120
TPSFRVITIG STF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018717722.11e-29PREDICTED: MADS-box transcription factor 27 isoform X3
TrEMBLA0A059ATD02e-27A0A059ATD0_EUCGR; Uncharacterized protein
STRINGXP_010029960.15e-28(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.21e-17AGAMOUS-like 16