PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS543292.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 137aa    MW: 15285 Da    PI: 6.3419
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS543292.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26082.65.9e-261712999
        DUF260 29 kfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                  kfanvhk+FGasnv+kll+++ +++red+++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+++++
  EcS543292.10  1 KFANVHKIFGASNVSKLLNEVLPHQREDTVNSLAYEAEARLKDPVYGCVGAISVLQRQVIRLQKELDATNA 71
                  69****************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031957.4E-25170IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089116.908173IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
KFANVHKIFG ASNVSKLLNE VLPHQREDTV NSLAYEAEAR LKDPVYGCVG AISVLQRQVI  60
RLQKELDATN ADLIQYTCRE MPSTVSRPVH YRRKNNNNMV QVYGDGGFDQ NCGGYYHPNA  120
WSNVHDGDGQ EGDDGGM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033314.11e-100PREDICTED: LOB domain-containing protein 25-like isoform X1
SwissprotQ8L8Q35e-43LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A059AGJ21e-100A0A059AGJ2_EUCGR; Uncharacterized protein
STRINGPOPTR_0001s35280.19e-54(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.13e-44LOB domain-containing protein 25