PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS509121.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 283aa    MW: 29694.4 Da    PI: 3.7588
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS509121.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF466.7e-15339945
                  HHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
        SRF-TF  9 rqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                  r vt+skRr+g++ KA+ L+ LC+a++av++fs+ gk
  EcS509121.10  3 RLVTYSKRRKGLFNKASQLCRLCGARAAVLVFSPAGK 39
                  88********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.713147IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-8146IPR002100Transcription factor, MADS-box
PfamPF003191.7E-17243IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-17262IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-6924IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-62445IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
AARLVTYSKR RKGLFNKASQ LCRLCGARAA VLVFSPAGKP CSFGDPSADE IIADYLRHGD  60
CDGDGDVTPP MSLTQWADWM ETEWEACATE EDLESLILKY EAVRDCARDK LKSLEEEASQ  120
VGVGGGESRI LGAEEIDALF EGLGQCPALS DLLTDGDGDG LLTPPENSAG GGEISAAEST  180
PALFDLEGHV SDAAGGGSFG AASTPTSSDL QDHGFDPDEL LNLSEDGDLE DNAFDPDGFL  240
NLLEDGEVDG GRKGPLISPE DSAVGGGYDA DDFFGLEDLH VLL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018720723.10.0PREDICTED: MADS-box transcription factor 47-like
TrEMBLA0A059D2A11e-132A0A059D2A1_EUCGR; Uncharacterized protein
STRINGXP_010045944.11e-168(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.16e-18AGAMOUS-like 29