PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC075578.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 138aa    MW: 15648.1 Da    PI: 8.2051
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC075578.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK352.9e-1199132437
        RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCR 37 
                   +++l d+  yF+lpi++A+  L +c+Tv+K+iC 
  EcC075578.10  99 KMTLADVGGYFHLPIEKASERLHLCPTVVKKICT 132
                   7999*****************************4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF020424.1E-999133IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MVSHAILDTQ HNPGAVPSNS EDWYQMFDFC KKSIQNVKFI LQQYCEGRRL AGYIMYQDPL  60
AMFYEAVCVG IDFNGNVNAD YFQLPLPPIV SVQRERAGKM TLADVGGYFH LPIEKASERL  120
HLCPTVVKKI CTKRRSGA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010024146.11e-84PREDICTED: protein RKD5-like
TrEMBLA0A059AAH11e-91A0A059AAH1_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40762342