PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC075475.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 64aa    MW: 7150.13 Da    PI: 7.8498
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC075475.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26091.69.3e-29264163
        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvy 63
                  +CaaCk +rrkC+++Cv+apyfpa+qp+kfa+vh++FGasnv kll++l+ ++reda++sl+y
  EcC075475.10  2 PCAACKCQRRKCTPECVFAPYFPADQPQKFAYVHEVFGASNVAKLLNELHVSQREDAANSLTY 64
                  7************************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089120.515164IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-28264IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 64 aa     Download sequence    Send to blast
SPCAACKCQR RKCTPECVFA PYFPADQPQK FAYVHEVFGA SNVAKLLNEL HVSQREDAAN  60
SLTY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010026421.19e-41PREDICTED: LOB domain-containing protein 36-like
SwissprotO044798e-34LBD6_ARATH; LOB domain-containing protein 6
TrEMBLA0A078IA775e-32A0A078IA77_BRANA; BnaA02g12180D protein
TrEMBLA0A0D3AN845e-32A0A0D3AN84_BRAOL; Uncharacterized protein
TrEMBLM4FF615e-32M4FF61_BRARP; Uncharacterized protein
TrEMBLR0GIM55e-32R0GIM5_9BRAS; Uncharacterized protein
STRINGBra039733.1-P2e-31(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.45e-35LBD family protein