PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC071705.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 219aa    MW: 24797.9 Da    PI: 10.9852
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC071705.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.41.4e-32104157255
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  EcC071705.10 104 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 157
                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.06E-16101158IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-29102157IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-24104157IPR006447Myb domain, plants
PfamPF002492.7E-7105156IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
WSPSISHSSS CSSKAFHSPA HYLGRSLNPF SILNSGTPDP SSSGYQIPAT GRFGGLSAYQ  60
LHQYHHHHHH HSQYAVIGSS EASHGMMRSR FVSKLPVKRS MRAPRMRWTS TLHARFVHAV  120
ELLGGHERAT PKSVLELMDV KDLTLAHVKS HLQMYRTVKT TDKPAASSGN AQCFSFTFFP  180
PKQRSNTIER ERERERERER ERERGENRKS SASLNLRGL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193203RERERERERER
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062308.19e-91PREDICTED: transcription repressor KAN1 isoform X2
SwissprotQ93WJ91e-49KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A059BUZ69e-91A0A059BUZ6_EUCGR; Uncharacterized protein
STRINGVIT_04s0043g00340.t014e-65(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-49G2-like family protein