PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC064765.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 95aa    MW: 10541 Da    PI: 3.902
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC064765.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26040.96e-1314061100
        DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                   +vyeA ar+rdPvyG++g i++lq+q+ +l+a+la++++e
  EcC064765.10   1 MVYEASARIRDPVYGCTGAISQLQKQVVELQAQLAKAQAE 40 
                   69**********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.41141IPR004883Lateral organ boundaries, LOB
PfamPF031958.7E-11138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MVYEASARIR DPVYGCTGAI SQLQKQVVEL QAQLAKAQAE VANLQCQNTN LFALICMEMS  60
QSQDQPVFQQ QCPAAMDASC FPDETNLVPS WELWA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010068859.17e-64PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR05e-22LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB9HLY27e-39B9HLY2_POPTR; Uncharacterized protein
STRINGPOPTR_0008s04350.12e-38(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-12LOB domain-containing protein 1