PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC057266.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 46aa    MW: 5087.87 Da    PI: 8.2104
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC057266.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26060.93.3e-19746140
        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGas 40
                  +CaaCk +rrkC+++Cv+apyfpa+qp+kfa+vh++FGas
  EcC057266.10  7 PCAACKCQRRKCTPECVFAPYFPADQPQKFAYVHEVFGAS 46
                  7*************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089116.313646IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-17746IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 46 aa     Download sequence    Send to blast
MSSLSSPCAA CKCQRRKCTP ECVFAPYFPA DQPQKFAYVH EVFGAS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010026421.12e-26PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ37e-21LBD36_ARATH; LOB domain-containing protein 36
TrEMBLK7KJC73e-20K7KJC7_SOYBN; Uncharacterized protein
TrEMBLA0A151SDG47e-20A0A151SDG4_CAJCA; LOB domain-containing protein 36
STRINGGLYMA04G11991.18e-20(Glycine max)
STRINGfgenesh2_kg.8__2729__AT5G66870.14e-19(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-22ASYMMETRIC LEAVES 2-like 1