PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055224.140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 208aa    MW: 23523.9 Da    PI: 6.0422
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055224.140genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.83.9e-201763349
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   i  k   qvtfskRr g++KKA+EL++LC++++ +i+fs+  k++ +
  EcC055224.140 17 IPKKNHLQVTFSKRRSGLFKKASELCTLCGVDIGIIVFSPASKVFSF 63
                   55677789**********************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.567767IPR002100Transcription factor, MADS-box
SMARTSM004328.5E-29766IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-24878IPR002100Transcription factor, MADS-box
CDDcd002652.57E-32876No hitNo description
PRINTSPR004041.8E-16929IPR002100Transcription factor, MADS-box
PfamPF003194.0E-231663IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-162944IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-164465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006869Biological Processlipid transport
GO:0008272Biological Processsulfate transport
GO:0016567Biological Processprotein ubiquitination
GO:0051603Biological Processproteolysis involved in cellular protein catabolic process
GO:0055085Biological Processtransmembrane transport
GO:0055114Biological Processoxidation-reduction process
GO:0060154Biological Processcellular process regulating host cell cycle in response to virus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0004497Molecular Functionmonooxygenase activity
GO:0004842Molecular Functionubiquitin-protein transferase activity
GO:0005506Molecular Functioniron ion binding
GO:0005525Molecular FunctionGTP binding
GO:0008270Molecular Functionzinc ion binding
GO:0008271Molecular Functionsecondary active sulfate transmembrane transporter activity
GO:0008289Molecular Functionlipid binding
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037Molecular Functionheme binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MAKKPSLGRQ KIAISKIPKK NHLQVTFSKR RSGLFKKASE LCTLCGVDIG IIVFSPASKV  60
FSFGHPEVEF IIDRFLAQDP APPDSGECRL IEAHRNANLR DLNGILTQVL EELEVERKRG  120
EALDEMRRES QRQCWWEAPI DELGLCELEQ LGGSMEELKK NVMRWINELM VDSCSPNGEI  180
AYESKPLEAN GAYNLGHVYN LHDQNGLF
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027322.11e-152PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK26e-53AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A059B7H11e-120A0A059B7H1_EUCGR; Uncharacterized protein
STRINGXP_010027322.11e-152(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.16e-49AGAMOUS-like 62
Publications ? help Back to Top
  1. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  2. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  3. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  4. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  5. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]