PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055215.110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 293aa    MW: 33215 Da    PI: 6.2898
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055215.110genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.61.8e-1786139356
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    k+++++ eq+++Le+ Fe  +++  e++ +LA+ l+L+ rq+ +WFqNrRa++k
  EcC055215.110  86 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALNLQPRQIAIWFQNRRARWK 139
                    456899***********************************************9 PP

2HD-ZIP_I/II1278.1e-4185175191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+L+lqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr++da+k++ne+L++++++L+ e+
  EcC055215.110  85 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALNLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQFDAVKADNETLQAQNQKLQIEI 175
                    69*************************************************************************************9776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-1970142IPR009057Homeodomain-like
SuperFamilySSF466891.96E-1977143IPR009057Homeodomain-like
PROSITE profilePS5007116.94181141IPR001356Homeobox domain
SMARTSM003897.2E-1784145IPR001356Homeobox domain
PfamPF000467.9E-1586139IPR001356Homeobox domain
CDDcd000863.63E-1686142No hitNo description
PROSITE patternPS000270116139IPR017970Homeobox, conserved site
PfamPF021831.5E-14141180IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
GO:0008168Molecular Functionmethyltransferase activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MAFFSPNFML QSPHDQDHEH PHHQHQHQIL SSCTPQDFHG VASLLGKRSM SFTGIDVGDD  60
PNINNGNVNG EEDLSEDDGS QPGGEKKRRL NMEQVKTLEK NFELGNKLEP ERKMQLARAL  120
NLQPRQIAIW FQNRRARWKT KQLEKDYDLL KRQFDAVKAD NETLQAQNQK LQIEILALKN  180
TREPAESINL NKETDQGSCS NRSENSSEIR LDMTRTPPVE SPVSGHAPPA AGRQLFPASM  240
RPAASGGSVA QLFQNPSRPD LPMIVKEESS ITNMFCGIED HSGFWPWLEQ QHY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133141RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066933.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-113ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A059BFV90.0A0A059BFV9_EUCGR; Uncharacterized protein
STRINGVIT_01s0026g01950.t011e-134(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-111HD-ZIP family protein