PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055210.110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 418aa    MW: 46606.6 Da    PI: 6.6519
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055210.110genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox681.2e-2157112156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    r+k ++++++q++eLe++F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
  EcC055210.110  57 RKKYHRHSPHQIQELEAFFKECPHPDEKQRLELSRRLGLESKQIKFWFQNRRTQMK 112
                    7999*************************************************999 PP

2START81.52e-262704172130
                    HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
          START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                    +a + ++el+k+a+ ++ +W +      e +n +e+ + f++  +       +ea+r++ +v+ ++  + e+l+d++ +W et++    + +t+ev
  EcC055210.110 270 VAIASMNELIKMAEPNSCLWLRTLdgakEVLNHEEYSRLFTPLASarhseVVTEASRETSIVPINSLAVIEILMDVN-RWVETFPcivaRSSTIEV 364
                    67899*******************99988888999988888766688888899************************.****************** PP

                    ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEE CS
          START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSv 130
                     ssg      galq+m ae+q+lsplvp R + f+R+++q+g+g w++vdvSv
  EcC055210.110 365 MSSGirgnrnGALQVMHAEFQVLSPLVPlRQVRFLRFCKQHGEGMWAVVDVSV 417
                    ****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.01E-2146114IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-2247116IPR009057Homeodomain-like
PROSITE profilePS5007117.99354114IPR001356Homeobox domain
SMARTSM003891.2E-1956118IPR001356Homeobox domain
PfamPF000463.1E-1957112IPR001356Homeobox domain
CDDcd000862.32E-1957115No hitNo description
PROSITE patternPS00027089112IPR017970Homeobox, conserved site
PROSITE profilePS5084824.407260418IPR002913START domain
SuperFamilySSF559613.3E-15263417No hitNo description
PfamPF018521.6E-20270417IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006869Biological Processlipid transport
GO:0007165Biological Processsignal transduction
GO:0008168Molecular Functionmethyltransferase activity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0051087Molecular Functionchaperone binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MEGHSEIDRF GEPFEGSFLG RLRDEGSGSD NQLDGASGDD DQDDAVDEEA GVVPRKRKKY  60
HRHSPHQIQE LEAFFKECPH PDEKQRLELS RRLGLESKQI KFWFQNRRTQ MKTQMERHEN  120
IMLRDDNNRL RNENDAMRSK LANPICGNCG GTAIFNGAGM VSYEEHQLRV ENARLKEEVA  180
RVRALTDKFL GKQPPTALLP SSPSRSNRGP EFSAQGHVPN VSTTATAALP IGISSLDGMS  240
NASPVSPYAR PAVAMGRNQL STEKSAYVDV AIASMNELIK MAEPNSCLWL RTLDGAKEVL  300
NHEEYSRLFT PLASARHSEV VTEASRETSI VPINSLAVIE ILMDVNRWVE TFPCIVARSS  360
TIEVMSSGIR GNRNGALQVM HAEFQVLSPL VPLRQVRFLR FCKQHGEGMW AVVDVSVG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15458RKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035104.10.0PREDICTED: homeobox-leucine zipper protein HDG1-like
SwissprotQ0WV121e-124ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A058ZYF30.0A0A058ZYF3_EUCGR; Uncharacterized protein
STRINGGLYMA10G38280.21e-159(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.21e-109HD-ZIP family protein