PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055207.80
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 174aa    MW: 19741.6 Da    PI: 9.9917
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055207.80genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.27.7e-221153345
                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                  + ++s rqvtfskRr+g++KKA+EL +LC++++a+i+fs+ gk
  EcC055207.80 11 VTDSSTRQVTFSKRRTGLFKKANELAILCAVQIAIIVFSPGGK 53
                  56899***********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-33160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-27173IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.988161IPR002100Transcription factor, MADS-box
CDDcd002656.16E-33271No hitNo description
PRINTSPR004041.7E-19323IPR002100Transcription factor, MADS-box
PfamPF003196.3E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006412Biological Processtranslation
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006812Biological Processcation transport
GO:0055085Biological Processtransmembrane transport
GO:0005840Cellular Componentribosome
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
GO:0015299Molecular Functionsolute:proton antiporter activity
GO:0016747Molecular Functiontransferase activity, transferring acyl groups other than amino-acyl groups
GO:0030170Molecular Functionpyridoxal phosphate binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MGRRKIEIEM VTDSSTRQVT FSKRRTGLFK KANELAILCA VQIAIIVFSP GGKPFSFGHP  60
NVESIVHRFR NQDRTPDEGT SKGAESRDEN TTDDNLNQKL LDLLKRLNAE EKRGEMLEKM  120
VKAKRAAKGQ PPVDQLGLPE LGELKRSFED LRRKLRDRID DMEAISSLLL LAEH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A7e-16169169MEF2C
5f28_B7e-16169169MEF2C
5f28_C7e-16169169MEF2C
5f28_D7e-16169169MEF2C
6byy_A6e-16169169MEF2 CHIMERA
6byy_B6e-16169169MEF2 CHIMERA
6byy_C6e-16169169MEF2 CHIMERA
6byy_D6e-16169169MEF2 CHIMERA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054261.11e-123PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLA0A059CBZ01e-121A0A059CBZ0_EUCGR; Uncharacterized protein
STRINGXP_010054261.11e-122(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.19e-37AGAMOUS-like 29