PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055207.100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 186aa    MW: 21137.3 Da    PI: 8.8565
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055207.100genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.17.1e-211253445
                   -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
         SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    ++  rqvtfskRr+g++KKA+EL +LC++++a+i+fs+ gk
  EcC055207.100 12 TDSCTRQVTFSKRRTGLFKKANELAILCAVRIAIIVFSPGGK 53
                   57889**********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.371161IPR002100Transcription factor, MADS-box
SMARTSM004324.1E-31160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.07E-26172IPR002100Transcription factor, MADS-box
CDDcd002653.34E-32275No hitNo description
PRINTSPR004041.1E-18323IPR002100Transcription factor, MADS-box
PfamPF003196.0E-231257IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006412Biological Processtranslation
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006812Biological Processcation transport
GO:0055085Biological Processtransmembrane transport
GO:0005840Cellular Componentribosome
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
GO:0015299Molecular Functionsolute:proton antiporter activity
GO:0016747Molecular Functiontransferase activity, transferring acyl groups other than amino-acyl groups
GO:0030170Molecular Functionpyridoxal phosphate binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MGRRKIEIEL VTDSCTRQVT FSKRRTGLFK KANELAILCA VRIAIIVFSP GGKPFSFGHP  60
NVESIVHRFL NQEKAPDEGT NKDAESRDES KTDDNLNQQI LDLLKRLNAE EKRGEMLEKA  120
LKAKRAAKGQ PPIDQLGLPE LGQLKRSLED LREKLKYCID EKEVLSAILL LSEQQPKKEN  180
QSENWV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A5e-16183183MEF2 CHIMERA
6byy_B5e-16183183MEF2 CHIMERA
6byy_C5e-16183183MEF2 CHIMERA
6byy_D5e-16183183MEF2 CHIMERA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054262.11e-130PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLA0A059CCK21e-129A0A059CCK2_EUCGR; Uncharacterized protein
STRINGXP_010054262.11e-130(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-36AGAMOUS-like 29