PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055180.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 780aa    MW: 86791.8 Da    PI: 6.9452
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055180.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.89.1e-193892256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                  ++ +++t++q+++Le++F++ ++p++++r++L+++lgL+ +q+k+WFqN+R+++k
  EcC055180.10 38 KTYHRHTPHQTQRLEAFFKEFPHPDENQRRQLSRELGLDPKQIKFWFQNKRTQRK 92
                  678899**********************************************998 PP

2START1203.1e-382504685206
                   HHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT CS
         START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg 88 
                    a++el++ +  +ep+W ks+     ++ +d++ q+f+++        + e++++s++v+m++ +lv+++ld++ +W  ++     ka+ + v+++g
  EcC055180.10 250 YAMDELIRIVRMKEPLWIKSPldgrYILHRDTYEQIFSRNYRfrgsgARLETSKESVLVTMEPSRLVNIFLDVR-KWADMFHtivtKASSIPVLEEG 345
                   6899******************99999**********88666999999**************************.******99999*********** PP

                   ......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX. CS
         START  89 ......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp. 177
                           lql+ a + +lsplvp R+++f+R ++q + g wvivdvS +  +      +     +lpSg++i++++ng skvtwvehv+++++   
  EcC055180.10 346 tqlnhrIYLQLIHARMHVLSPLVPaREVYFLRRCQQIELGMWVIVDVSYNYMTGDACPYNTW---RLPSGCVIQDMGNGCSKVTWVEHVEVDDKNQa 439
                   999999999***************************************98877765433455...5*************************988766 PP

                   HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
         START 178 hwllrslvksglaegaktwvatlqrqcek 206
                   h l+r lv  gl  ga +w  tlqr ce+
  EcC055180.10 440 HKLFRDLVCGGLTYGAERWAITLQRMCER 468
                   ***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.77E-182095IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-192288IPR009057Homeodomain-like
PROSITE profilePS5007116.3093494IPR001356Homeobox domain
SMARTSM003891.6E-163698IPR001356Homeobox domain
PfamPF000462.5E-163892IPR001356Homeobox domain
CDDcd000867.64E-173895No hitNo description
PROSITE patternPS0002706992IPR017970Homeobox, conserved site
PROSITE profilePS5084837.933237471IPR002913START domain
SuperFamilySSF559612.06E-26240470No hitNo description
CDDcd088751.08E-87245467No hitNo description
SMARTSM002341.9E-18246468IPR002913START domain
PfamPF018529.2E-31250468IPR002913START domain
SuperFamilySSF559619.2E-11496602No hitNo description
SuperFamilySSF559619.2E-11647714No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006102Biological Processisocitrate metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0000287Molecular Functionmagnesium ion binding
GO:0004450Molecular Functionisocitrate dehydrogenase (NADP+) activity
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0051287Molecular FunctionNAD binding
Sequence ? help Back to Top
Protein Sequence    Length: 780 aa     Download sequence    Send to blast
MADSGGSGGS GEEHEHRQDS HPSPNPSSSS RKGKGKSKTY HRHTPHQTQR LEAFFKEFPH  60
PDENQRRQLS RELGLDPKQI KFWFQNKRTQ RKTQNERADN TALRAENERI HCENLAIMEA  120
LKSVICPACG GPPFGEEERQ RNLEKLKMEN VQLKEEAISV LIDVLSANVM QHAKVSKILA  180
KYIGKPISQI DLLMPGPRSS ADVSTASAPN QGFSGQNVDF VVAPPNPASW SQLKVIPETE  240
MANTLEITAY AMDELIRIVR MKEPLWIKSP LDGRYILHRD TYEQIFSRNY RFRGSGARLE  300
TSKESVLVTM EPSRLVNIFL DVRKWADMFH TIVTKASSIP VLEEGTQLNH RIYLQLIHAR  360
MHVLSPLVPA REVYFLRRCQ QIELGMWVIV DVSYNYMTGD ACPYNTWRLP SGCVIQDMGN  420
GCSKVTWVEH VEVDDKNQAH KLFRDLVCGG LTYGAERWAI TLQRMCERFA YSMLDDAPTH  480
DAVEVGITTS PVIVVPEGRR NVMKLAHRMV KNFSAGLSMS GKLDFPHLSE VNNSGVRVCV  540
RKSEEPGQPS GTIVSAATSL WLPVAPQAVF NFFRNENTRA QWDVLCNGNP VQEIARIPSG  600
THHGNSISII QVIFSLLRML ITETPLEEEL NNTDIMRDSS AFHWETVCLF SSPQTSLHAE  660
NMLMLQESCI DPLTCMVVYA PIDSTAMTIA LSGEDTSTVQ ILPSGFTISS DGRANPGSKP  720
STSTSSSKPA GTLLTAAFQI LVSSHSGPEQ LDVESVATVN TLISATVQKI KAALNCSAPE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064845.10.0PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein ROC8
TrEMBLA0A059BV030.0A0A059BV03_EUCGR; Uncharacterized protein
STRINGVIT_04s0079g00480.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03260.10.0homeodomain GLABROUS 8