PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055061.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 184aa    MW: 20715.3 Da    PI: 10.1895
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055061.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.65.8e-171563149
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                  k+ien+s r +tfskR+  i KKA+EL +LC+aev  + fs++g+ + +
  EcC055061.30 15 KQIENESSRLITFSKRKSSINKKASELVTLCGAEVGFVAFSPSGNPFSF 63
                  78*****************************************986666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.7E-16766IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-13929IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.0071467IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-211487IPR002100Transcription factor, MADS-box
PfamPF003191.2E-201763IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-132944IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-134465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MAGRQTGENP RPGMKQIENE SSRLITFSKR KSSINKKASE LVTLCGAEVG FVAFSPSGNP  60
FSFAHPSIDA VANRFLNRNP SPNNSSQPLV ESYRQAKCKE LNQQHDELYN QIKAEKAQGK  120
ALKRLTKGKS DAAWWEAPIE ELNREELYQM KGRMEELRRS LKRSINQKFQ GEASGSSQGQ  180
ELEK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157163RRSLKRS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059060.11e-129PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLA0A059C7K01e-104A0A059C7K0_EUCGR; Uncharacterized protein (Fragment)
STRINGXP_010059060.11e-129(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.14e-37AGAMOUS-like 61