PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055035.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 373aa    MW: 41799.5 Da    PI: 9.6972
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055035.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32191244255
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  EcC055035.40 191 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 244
                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15188244IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28188244IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23191244IPR006447Myb domain, plants
PfamPF002492.4E-7192243IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0019348Biological Processdolichol metabolic process
GO:0030176Cellular Componentintegral component of endoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
GO:0003950Molecular FunctionNAD+ ADP-ribosyltransferase activity
GO:0005509Molecular Functioncalcium ion binding
GO:0030234Molecular Functionenzyme regulator activity
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PTSTWRRSTD QEEANLSFWK KALDSRSSLS SMSKPDTRPE  60
LSPSSTTLFT GSGPDTHPLL QKRSSNSLVH RFQEKNHKTV YQQHLQHNPL GQEVETLRPI  120
RGIPLYQNTS FPFSHHQQQQ PLELIANSSL SSLANNTAIS RSSSNRFHSH GLMRSRLASR  180
FPGPKRSTRA PRMRWTTTLH ARFVHAVELL GGHERATPKS VLELMDVKDL TLAHVKSHLQ  240
MYRTVKTTDK TAASSGQSEV LDNASSGDTS EDLVFEIGNS RGPETSIQQG ELNNQEKDYY  300
APKWSKSARE AWKQGKLPED DFIGNCATYV EEDRNAKCPS NERILDVNSP NLSGTSNNMK  360
PNLEFTLGRS SSH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053635.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6161e-82KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A059CIK10.0A0A059CIK1_EUCGR; Uncharacterized protein
STRINGVIT_02s0012g01940.t011e-126(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.16e-79G2-like family protein