PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054953.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 260aa    MW: 28843.6 Da    PI: 8.3045
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054953.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.2e-3346100155
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   kprl+Wt++LH+rFveav+qLGG++kAtPk+il++m+++gLtl+h+kSHLQkYRl
  EcC054953.30  46 KPRLKWTTDLHKRFVEAVNQLGGADKATPKSILKAMGIPGLTLYHLKSHLQKYRL 100
                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.43643103IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-3144101IPR009057Homeodomain-like
SuperFamilySSF466892.15E-1745101IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-2446101IPR006447Myb domain, plants
PfamPF002495.2E-104899IPR001005SANT/Myb domain
PfamPF143798.8E-21143189IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MHNHSLYGGK NFHPSSRMSI LSERHLLLQA ANGPGDSGLI LSTDAKPRLK WTTDLHKRFV  60
EAVNQLGGAD KATPKSILKA MGIPGLTLYH LKSHLQKYRL SKNLHGQATN GTNRAVAEVK  120
VSEANGPHLN NSSIGIQVNK NLHISEAFQV QIEVQRRLHE QMEAQRHMQL HIEAQGKYLQ  180
AVLEKAQETL GRHDSGSVGL EAAKYQLSEL VSKVSADSLS STFPDVVDIH LHQMQMNQNT  240
DGSLDSCLTC ERPQKDREED
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054431.10.0PREDICTED: myb family transcription factor APL isoform X2
SwissprotQ9SAK56e-52APL_ARATH; Myb family transcription factor APL
TrEMBLA0A059DGG50.0A0A059DGG5_EUCGR; Uncharacterized protein
STRINGGLYMA13G39290.21e-118(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-108G2-like family protein