PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054947.80
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 60aa    MW: 6660.81 Da    PI: 11.0659
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054947.80genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.32.4e-291059251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  ri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsstgkly+++s
  EcC054947.80 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTGKLYDFAS 59
                  8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.651160IPR002100Transcription factor, MADS-box
SMARTSM004323.7E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-28259IPR002100Transcription factor, MADS-box
CDDcd002652.34E-37260No hitNo description
PRINTSPR004042.3E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.6E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055085Biological Processtransmembrane transport
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TGKLYDFAST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A5e-20160160MEF2C
5f28_B5e-20160160MEF2C
5f28_C5e-20160160MEF2C
5f28_D5e-20160160MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490465.13e-35MADS-box transcription factor 23-like isoform X2
RefseqXP_004490466.12e-35MADS-box transcription factor 23-like isoform X3
RefseqXP_012568392.12e-35MADS-box transcription factor 23-like isoform X3
RefseqXP_021283893.16e-36MADS-box transcription factor 27-like
RefseqXP_026433223.16e-36MADS-box transcription factor 27-like isoform X6
SwissprotA2RVQ52e-31AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLA0A498JET22e-34A0A498JET2_MALDO; Uncharacterized protein
TrEMBLW9RX213e-34W9RX21_9ROSA; MADS-box transcription factor 27
STRINGXP_010104581.15e-35(Morus notabilis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.18e-34AGAMOUS-like 16
Publications ? help Back to Top
  1. Yang K,Jiang M,Le J
    A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell.
    J Integr Plant Biol, 2014. 56(6): p. 539-49
    [PMID:24386951]