PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054892.60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 742aa    MW: 82080.3 Da    PI: 6.8713
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054892.60genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox651.1e-202075156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                  +++ +++t++q+++Le +F+++++p++++r eL+++lgL  rq+k+WFqNrR+++k
  EcC054892.60 20 KKRYHRHTAHQIQRLEGMFRECPHPDEKQRMELSRELGLAPRQIKFWFQNRRTQMK 75
                  688999***********************************************998 PP

2START147.11.7e-462184722206
                   HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
         START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                   +a  a++e++++a+ +ep+W+ks     +++n + + + f+++ +       ++ea+r+s+vv m+   l   +++++ +W e ++    +a+t+ev
  EcC054892.60 218 IAANALDEFLRLAQTDEPLWMKSTtdgrDNLNLESYERMFPRASShlknpdVRVEASRESRVVMMNGLALIDMFMNSN-KWAELFPaivsAAKTIEV 313
                   577899*********************99999999999999988899***99**************************.****************** PP

                   ECTT....................................EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE CS
         START  85 issg....................................galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvR 144
                   is+g                                     +  +m+ elq+lspl p R+f+f+Ry++q + g w+ivdvS d  ++ +  +   R
  EcC054892.60 314 ISPGlltsqngslqlvthfasphllrisylatcfklnshpWEKMQMYEELQVLSPLIPtREFYFLRYCQQIEPGLWAIVDVSFDLSRYDQ-FAFQSR 409
                   **************************************998888999******************************************9.79999* PP

                   -EESSEEEEEEEECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
         START 145 aellpSgiliepksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                   +++lpSg+li++++ng+skvtwvehv+ +++ p h l+r l+ +gla+ga +w atl+r ce+
  EcC054892.60 410 SQRLPSGCLIQDLPNGYSKVTWVEHVEIEDKAPvHRLYRDLIYNGLAFGAERWIATLERMCER 472
                   *************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.77E-21677IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-23979IPR009057Homeodomain-like
PROSITE profilePS5007117.9611777IPR001356Homeobox domain
SMARTSM003892.8E-191881IPR001356Homeobox domain
PfamPF000464.5E-182075IPR001356Homeobox domain
CDDcd000866.03E-182078No hitNo description
PROSITE patternPS0002705275IPR017970Homeobox, conserved site
PROSITE profilePS5084848.715208475IPR002913START domain
SuperFamilySSF559612.33E-32209319No hitNo description
CDDcd088751.19E-109212471No hitNo description
SMARTSM002346.6E-33217472IPR002913START domain
PfamPF018522.3E-39218472IPR002913START domain
SuperFamilySSF559612.33E-32357473No hitNo description
Gene3DG3DSA:3.30.530.201.5E-4365440IPR023393START-like domain
SuperFamilySSF559611.19E-22493734No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0035556Biological Processintracellular signal transduction
GO:0005634Cellular Componentnucleus
GO:0000166Molecular Functionnucleotide binding
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MDFGGGSGGD HDGSDHQKRK KRYHRHTAHQ IQRLEGMFRE CPHPDEKQRM ELSRELGLAP  60
RQIKFWFQNR RTQMKAQHER ADNCALRAEN DRIRCENIVI REALRNVICP SCGTVPSGED  120
SYFDEQKLRM ENAHLKEELD RVSSIAAKYI GRPMSQLPPV QPIHIASLDL TMSSLGAHGL  180
AGPSLDLDLL PGSSSSVPHL PFQAVVFSDM DKSLMADIAA NALDEFLRLA QTDEPLWMKS  240
TTDGRDNLNL ESYERMFPRA SSHLKNPDVR VEASRESRVV MMNGLALIDM FMNSNKWAEL  300
FPAIVSAAKT IEVISPGLLT SQNGSLQLVT HFASPHLLRI SYLATCFKLN SHPWEKMQMY  360
EELQVLSPLI PTREFYFLRY CQQIEPGLWA IVDVSFDLSR YDQFAFQSRS QRLPSGCLIQ  420
DLPNGYSKVT WVEHVEIEDK APVHRLYRDL IYNGLAFGAE RWIATLERMC ERIACLMVTG  480
SSTRDTRGVI PSPDGKRSMM KLAQRMVNNF CSSISTSSSR QQRWTTLSGS SEVGVRVALH  540
KSTDPGQPNG VVLSAATTIW LPLSPQNIFN FFKDERTRAQ WDVLSNGNAV QEVAHLANGS  600
HPGNCISVLR AFNTSQNNML ILQESCIDSS GSLIVYCPVD LPAINLAMSG EDPSYIPLLP  660
SGFTISPDGG PDPGDGASSS SAAAAGQGST GRSAGSLMTV AFQILVSSLP SAKLNLESVT  720
TVNNLISTTV HQIKAALNCP GS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010069492.10.0PREDICTED: homeobox-leucine zipper protein HDG11
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A059AW260.0A0A059AW26_EUCGR; Uncharacterized protein
STRINGVIT_17s0053g00780.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11