PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054713.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 196aa    MW: 20948 Da    PI: 8.721
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054713.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601361.4e-42181171100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ael+++
  EcC054713.30  18 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQIQSLQAELNAV 114
                   7***********************************************************************************************9 PP

        DUF260  98 kee 100
                   ++e
  EcC054713.30 115 RSE 117
                   987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.99217118IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4218115IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006810Biological Processtransport
GO:0006979Biological Processresponse to oxidative stress
GO:0055114Biological Processoxidation-reduction process
GO:0016020Cellular Componentmembrane
GO:0003677Molecular FunctionDNA binding
GO:0004601Molecular Functionperoxidase activity
GO:0005215Molecular Functiontransporter activity
GO:0020037Molecular Functionheme binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MGRRHMLGPP GTLNTITPCA ACKLLRRRCA QECPFSPYFS PHEPQKFASV HKVFGASNVS  60
KMLMEVPESQ RADAANSLVY EANVRLRDPV YGCMGAISAL QQQIQSLQAE LNAVRSEILK  120
YKYREAGIIS PTSHVTLLSP GTVSIAAPPP TPPPQSAPTS LPPPLPPASS PPSLFTQPGG  180
TTDYGGISSE NVSYFG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067591.11e-142PREDICTED: LOB domain-containing protein 15 isoform X1
SwissprotQ8L5T53e-77LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A059BI151e-142A0A059BI15_EUCGR; Uncharacterized protein
STRINGVIT_13s0067g02380.t011e-104(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-72LOB domain-containing protein 15