PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054694.60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family BBR-BPC
Protein Properties Length: 280aa    MW: 31578.3 Da    PI: 10.1466
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054694.60genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind352.96.9e-10812801301
     GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerd.........maflqrdkalaernkalverdnkllal 84 
                   mddd+ + rn+gyyep+   k +l+lqlms++aerd+k+    r+  + l ++++a+++rd          ++  rd+++++        ++k++++
  EcC054694.60   1 MDDDALNMRNWGYYEPS--CKGHLNLQLMSTMAERDTKPflpgRDPTI-LVAPNGAYHPRDsvvsdtplqYNY-ARDSWMNQ--------REKFFNM 85 
                   9***9999*******99..9*********************9999888.9***********999999987777.89999999........789**** PP

     GAGA_bind  85 llvenslasalpvgvqvlsgtksidslqqlse.pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkk 180
                   l+ +++        + +l++++ ++++q+l+  + l+d+ ++    + +e    e ++ ++ke++++kkrq++  pk++kakk kk    +k+++++
  EcC054694.60  86 LPPNHN--------YAMLPESSGAHNMQMLQMpESLRDDRIG----R-IE----EPSPGVKKENPQPKKRQSNGIPKTPKAKKSKK----PKDNTNP 161
                   **9997........899***********94332445555555....2.22....23578899999***************999999....4556677 PP

     GAGA_bind 181 esaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGy 277
                   +   +r+k +kks+d+v+ng+++D+s++P+PvCsCtGa++qCY+WG+GGWqSaCCtt++S+yPLP+stkrrgaRiagrKmSqgafkk+LekLaaeGy
  EcC054694.60 162 PI--QRAKPPKKSMDVVINGIDMDISGIPIPVCSCTGAPQQCYRWGCGGWQSACCTTQVSMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAAEGY 256
                   76..79******************************************************************************************* PP

     GAGA_bind 278 dlsnpvDLkdhWAkHGtnkfvtir 301
                   ++snp+DL++hWAkHGtnkfvtir
  EcC054694.60 257 NFSNPIDLRTHWAKHGTNKFVTIR 280
                   ***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062177.3E-1161280IPR010409GAGA-binding transcriptional activator
SMARTSM012266.5E-1721280IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030001Biological Processmetal ion transport
GO:0042545Biological Processcell wall modification
GO:0046856Biological Processphosphatidylinositol dephosphorylation
GO:0055085Biological Processtransmembrane transport
GO:0005618Cellular Componentcell wall
GO:0005739Cellular Componentmitochondrion
GO:0009524Cellular Componentphragmoplast
GO:0009536Cellular Componentplastid
GO:0009574Cellular Componentpreprophase band
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0008017Molecular Functionmicrotubule binding
GO:0015299Molecular Functionsolute:proton antiporter activity
GO:0030599Molecular Functionpectinesterase activity
GO:0046873Molecular Functionmetal ion transmembrane transporter activity
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDDDALNMRN WGYYEPSCKG HLNLQLMSTM AERDTKPFLP GRDPTILVAP NGAYHPRDSV  60
VSDTPLQYNY ARDSWMNQRE KFFNMLPPNH NYAMLPESSG AHNMQMLQMP ESLRDDRIGR  120
IEEPSPGVKK ENPQPKKRQS NGIPKTPKAK KSKKPKDNTN PPIQRAKPPK KSMDVVINGI  180
DMDISGIPIP VCSCTGAPQQ CYRWGCGGWQ SACCTTQVSM YPLPMSTKRR GARIAGRKMS  240
QGAFKKVLEK LAAEGYNFSN PIDLRTHWAK HGTNKFVTIR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066541.10.0PREDICTED: protein BASIC PENTACYSTEINE2
SwissprotQ9SKD01e-109BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A059BEL20.0A0A059BEL2_EUCGR; Uncharacterized protein
STRINGVIT_01s0011g06380.t011e-151(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-106basic pentacysteine 2