PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054678.140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 159aa    MW: 17511.9 Da    PI: 8.2239
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054678.140genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601383.3e-4391081100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+Ck+lrr+C+kdC++apyfp ++p+kfa+vhk+FGasn++k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg+i+ lq+q+++l+ +la+
  EcC054678.140   9 PCASCKLLRRRCSKDCIFAPYFPPHDPHKFAIVHKVFGASNLSKMLQELPVNQRGDAVSSLVYEANARVRDPVYGCVGTISYLQNQVSELQLQLAA 104
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  EcC054678.140 105 AQAE 108
                    9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3988109IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-439106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046274Biological Processlignin catabolic process
GO:0055114Biological Processoxidation-reduction process
GO:0071805Biological Processpotassium ion transmembrane transport
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0016020Cellular Componentmembrane
GO:0048046Cellular Componentapoplast
GO:0005507Molecular Functioncopper ion binding
GO:0005515Molecular Functionprotein binding
GO:0015079Molecular Functionpotassium ion transmembrane transporter activity
GO:0016747Molecular Functiontransferase activity, transferring acyl groups other than amino-acyl groups
GO:0016758Molecular Functiontransferase activity, transferring hexosyl groups
GO:0016788Molecular Functionhydrolase activity, acting on ester bonds
GO:0052716Molecular Functionhydroquinone:oxygen oxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MGGSSGSSPC ASCKLLRRRC SKDCIFAPYF PPHDPHKFAI VHKVFGASNL SKMLQELPVN  60
QRGDAVSSLV YEANARVRDP VYGCVGTISY LQNQVSELQL QLAAAQAEVL SLQMHQKPHL  120
VQQDRETSFL MAGDNFNSVS HYIAASVIQD PLKRESFST
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045372.11e-116PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW37e-71LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A059DAN81e-116A0A059DAN8_EUCGR; Uncharacterized protein
STRINGPOPTR_0001s28840.11e-79(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-55LBD family protein