PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054671.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 187aa    MW: 21140.6 Da    PI: 10.0517
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054671.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.99.5e-171153345
                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                  i n+  r +t+ kR++g++KKA+E  +LC+++ ++ii+++ g 
  EcC054671.20 11 IPNEKARRITYEKRKKGMMKKAQEFTTLCGVDTCMIIYGPAGS 53
                  78999***********************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.7E-19160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.829152IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-20299IPR002100Transcription factor, MADS-box
CDDcd002661.19E-20289No hitNo description
PRINTSPR004041.2E-9323IPR002100Transcription factor, MADS-box
PfamPF003196.6E-171153IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009850Biological Processauxin metabolic process
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0010210Molecular FunctionIAA-Phe conjugate hydrolase activity
GO:0010211Molecular FunctionIAA-Leu conjugate hydrolase activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MGRRKLVLEL IPNEKARRIT YEKRKKGMMK KAQEFTTLCG VDTCMIIYGP AGSAATTEPE  60
IWPASPEKVK CIIERYMSKG VDRRAKRMVG LPEFFADRNK KVNAELAKVR LANGEAKYPI  120
SEALIDGLSE EDMRRLLGSL GNKLEAAKAR LAVMKEDAMR RSSSLMNDHN LPANDHTYNH  180
HHHMPCS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037296.11e-132PREDICTED: agamous-like MADS-box protein AGL82
RefseqXP_018720655.11e-132PREDICTED: agamous-like MADS-box protein AGL82
TrEMBLA0A059A6L71e-130A0A059A6L7_EUCGR; Uncharacterized protein
STRINGXP_010037296.11e-131(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.12e-26AGAMOUS-like 82