PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054589.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 88aa    MW: 10017.9 Da    PI: 10.4715
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054589.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.43.3e-27958150
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                  kri++++ rqvtfskRr+g++KKA ELS+LCdaev +i+fs tgkly++ 
  EcC054589.30  9 KRIDDSTSRQVTFSKRRKGLIKKARELSILCDAEVGLIVFSCTGKLYDFV 58
                  79**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.572161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-37160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-28163IPR002100Transcription factor, MADS-box
CDDcd002653.72E-36260No hitNo description
PRINTSPR004049.9E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016758Molecular Functiontransferase activity, transferring hexosyl groups
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGRGKIVIKR IDDSTSRQVT FSKRRKGLIK KARELSILCD AEVGLIVFSC TGKLYDFVSS  60
RLDLFLILPS FKVKSLLCYA QYFSLTSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A7e-20182172MEF2C
5f28_B7e-20182172MEF2C
5f28_C7e-20182172MEF2C
5f28_D7e-20182172MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010068314.21e-34PREDICTED: MADS-box transcription factor 23-like
SwissprotQ9SZJ63e-33AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBLA0A2C9UVZ97e-32A0A2C9UVZ9_MANES; Uncharacterized protein
STRINGXP_010068314.16e-34(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.11e-35AGAMOUS-like 21
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Yu LH, et al.
    Arabidopsis MADS-Box Transcription Factor AGL21 Acts as Environmental Surveillance of Seed Germination by Regulating ABI5 Expression.
    Mol Plant, 2017. 10(6): p. 834-845
    [PMID:28438576]
  3. Qu Y, et al.
    Peroxisomal CuAO╬ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]
  4. Sun CH, et al.
    Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis.
    Plant Sci., 2018. 266: p. 27-36
    [PMID:29241564]