PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054128.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 458aa    MW: 48881.3 Da    PI: 5.5222
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054128.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.51.5e-171052244
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                   ien+s r+ ++ kRr+g+lKKA ELS+LC++e + i+ s++ 
  EcC054128.40 10 YIENESARKSSLKKRRQGLLKKARELSILCGVETCAIVWSPDE 52
                  59**************************************974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.474149IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-22160IPR002100Transcription factor, MADS-box
CDDcd002662.87E-29286No hitNo description
SuperFamilySSF554556.54E-23394IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-8323IPR002100Transcription factor, MADS-box
PfamPF003199.0E-171157IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0015074Biological ProcessDNA integration
GO:0000166Molecular Functionnucleotide binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MARKKVKLAY IENESARKSS LKKRRQGLLK KARELSILCG VETCAIVWSP DENEPATWPT  60
SPVEVEDLLT RYLSIPEIER SRKMVNQETY LRERNHKLTE QHKKLDRKNK DLENHYLMQQ  120
LYLYEKTTSA LALDELKKLL SYVEEKIVEI ERRIEYIERR DSAPQSGGAP LAVEGPADKE  180
EEEEETTPRA NIGVVGGDGS GGGGDASSWD DWFSDMMKQS GHAAGSSSSK RETSYPLAYS  240
TGGAGTSSHD VAINLPQGNV GVGSGNQGHG GGPIYGGDNY PMMPYQGYIG DMSGGLPVRF  300
PPGSAIGGAY GYAMGPPYQW EVGRSSSGYG PVFPYGGVYR SNTNIINVAM QPQENPGGMN  360
SGQGMSLPVA TGGASGMGVY QRNDMVAGVP MLVPPPGNAN TSSAEYGFGV NQGNAAARSQ  420
GGGHGGYGVV MPPGNTGNEL WMPPDNAGAD AGRSGGNN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAYIENESARKSSLKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010024527.11e-135PREDICTED: glycine-rich cell wall structural protein 2-like
STRINGXP_010024527.11e-134(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.12e-25AGAMOUS-like 48