PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC053802.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bZIP
Protein Properties Length: 147aa    MW: 16701.6 Da    PI: 9.6229
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC053802.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.13.3e-07711141154
                   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1  11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                    +NR A  rsR+RKka +  Le k+k Le++ ++L   l+    
  EcC053802.10  71 LRNRDATVRSRERKKAHVRDLEVKSKYLEGKCRRLGRLLQCVMA 114
                   69****************************99888766655555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579591.13E-770121No hitNo description
CDDcd147041.54E-1171117No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-771124No hitNo description
PfamPF077167.0E-572105IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MKNYVIVPHF CHVVLLVFGY FVAVRFEIEE VLAHNRELAC IPCYLVSLVF SKALELPRQA  60
PNVATSKAPQ LRNRDATVRS RERKKAHVRD LEVKSKYLEG KCRRLGRLLQ CVMAENQALR  120
FSLENNACRA SVAKQESAVL SGMCLEP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018728287.11e-44PREDICTED: bZIP transcription factor 60-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.16e-18basic region/leucine zipper motif 60