PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC053697.70
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YB
Protein Properties Length: 146aa    MW: 15700.6 Da    PI: 7.4139
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC053697.70genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1802.1e-5627121195
         NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                   vreqdr+lPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yre ++
  EcC053697.70  27 VREQDRYLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYLDPLKIYLARYREGDT 121
                   69*****************************************************************************************9665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.1E-5325128IPR009072Histone-fold
SuperFamilySSF471131.18E-3930127IPR009072Histone-fold
PfamPF008082.3E-283397IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.0E-206179No hitNo description
PROSITE patternPS0068506480IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.0E-208098No hitNo description
PRINTSPR006152.0E-2099117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0006260Biological ProcessDNA replication
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006979Biological Processresponse to oxidative stress
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004601Molecular Functionperoxidase activity
GO:0004842Molecular Functionubiquitin-protein transferase activity
GO:0005524Molecular FunctionATP binding
GO:0008270Molecular Functionzinc ion binding
GO:0020037Molecular Functionheme binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MAEAPASPGG GGSHESGEHS PRSGGAVREQ DRYLPIANIS RIMKKALPAN GKIAKDAKET  60
VQECVSEFIS FITSEASDKC QREKRKTING DDLLWAMATL GFEDYLDPLK IYLARYREGD  120
TKGSAKVGEA STKRDGAAVQ SVPNAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-4826118193NF-YB
4awl_B2e-4826118294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4826118294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010046844.11e-101PREDICTED: nuclear transcription factor Y subunit B-1
SwissprotQ8VYK49e-75NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A059DEF21e-102A0A059DEF2_EUCGR; Uncharacterized protein
STRINGXP_010046844.11e-101(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.13e-71nuclear factor Y, subunit B10
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]