PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC053585.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 95aa    MW: 11090 Da    PI: 9.6354
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC053585.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.39.7e-19454151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  k+ien ++rqvtfskRr  ++KK +E  + Cd+++a + fs++g+l  ++s
  EcC053585.20  4 KKIENATKRQVTFSKRRSSLMKKINETAICCDIDAAFVAFSPSGRLSKFCS 54
                  78**********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.717156IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-16155IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-22275IPR002100Transcription factor, MADS-box
PfamPF003196.0E-19552IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-71833IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-73354IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MDIKKIENAT KRQVTFSKRR SSLMKKINET AICCDIDAAF VAFSPSGRLS KFCSRNRIED  60
VLQRYLNLPP EEKHQYDALV YLIIFLRFNL IEAAF
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015159179.12e-34PREDICTED: agamous-like MADS-box protein AGL104
SwissprotQ9LM462e-23AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLA0A022QWZ76e-34A0A022QWZ7_ERYGU; Uncharacterized protein (Fragment)
STRINGMigut.H02389.1.p1e-33(Erythranthe guttata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.19e-26AGAMOUS-like 104
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]