PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC053493.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 338aa    MW: 37965.2 Da    PI: 7.2586
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC053493.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF39.66.6e-133177349
                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                  i +    + tfskR   i+ KA+ELS L+ a vavi+fs+ gkl+ +
  EcC053493.10 31 IHDRNWCSNTFSKRHGCIINKASELSELTHAPVAVILFSPGGKLKHF 77
                  555566678***********************************998 PP

2SRF-TF33.26.5e-11167207949
                   HHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
        SRF-TF   9 rqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 
                    +  fs R n +lKKA+ELS  +++ vavi fs+ g+l+ +
  EcC053493.10 167 CSNKFSSRSNCLLKKASELSKDTGTPVAVITFSPAGNLKSF 207
                   55679*********************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-41480IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.28E-142792IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.5962781IPR002100Transcription factor, MADS-box
PfamPF003198.6E-133077IPR002100Transcription factor, MADS-box
SMARTSM004320.031151210IPR002100Transcription factor, MADS-box
PROSITE profilePS5006610.316151211IPR002100Transcription factor, MADS-box
PfamPF003191.5E-9164207IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-10168222IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000394Biological ProcessRNA splicing, via endonucleolytic cleavage and ligation
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003690Molecular Functiondouble-stranded DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MTTMHTGSSS SRPPRTPRQS VRPPPKETEK IHDRNWCSNT FSKRHGCIIN KASELSELTH  60
APVAVILFSP GGKLKHFERP SMEQVFSTYL CHKYGVKPPM STEAERESES CLTKEGCAFW  120
IMNYLDAVVR LLKKFLGFGN DPSFLQPIRS LSTRNMQTGS SLDRKRCSNK FSSRSNCLLK  180
KASELSKDTG TPVAVITFSP AGNLKSFGWP SIEEVFSTYL CHEYGMKPPM SAEVERECES  240
CLTKEDCASL VMNYLEAVIR LLRKLKDFEV HEIFPLIDDF RAIAPEAHYN IFVRPNHVVD  300
RSDPAADGES SGVDSDSTGF NIHEYLNLPD GDFLPTLP
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.12e-09AGAMOUS-like 15