PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC053489.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 356aa    MW: 38290 Da    PI: 8.2447
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC053489.50genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF481.6e-151051243
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                  +ien++ r+ ++ kRr+g++KK + LS+LC+++ + ii+s++
  EcC053489.50 10 FIENDTSRKASLKKRRQGLMKKVSQLSTLCGVNTCAIIYSPD 51
                  8***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.918149IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-22160IPR002100Transcription factor, MADS-box
CDDcd002661.58E-31285No hitNo description
SuperFamilySSF554553.79E-23395IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-7323IPR002100Transcription factor, MADS-box
PfamPF003193.3E-161052IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0003677Molecular FunctionDNA binding
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MARRKVKLAF IENDTSRKAS LKKRRQGLMK KVSQLSTLCG VNTCAIIYSP DSNEPVFWPS  60
RPEVEQLLER YQGFSELVRS RKMLNHESYL KEQINKLIGQ KNKLVVKNKG LKNTYLMQQL  120
CLYGKTTSEF ANDEMCSLFY YVHEKNKEIE KRIELLERTD GAPRSGSAPS AIDGPVVEEE  180
IILEAKGGGI GNANEDNTGD ASSSLDQWFI DMMKTGNTGS GSGSKKDKLY PLACLTGSAS  240
TYNQVIALNF IKENDGIGSG NWANRIGPVN GDAGGSRGNN IVLSQGPSGV IPGRGDSVTY  300
GHVGGSASNN AATPYQGYAG DMSNGSGIIC PNGDAGGCGD GATGYGVRLF NQWDAG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RRKVKLAFIENDTSRKASLKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGXP_010024022.11e-140(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.24e-27M-type_MADS family protein