PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC053395.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 305aa    MW: 33737.7 Da    PI: 4.7564
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC053395.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK61.41.6e-19261305448
        RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRk 48 
                   +++l d+  yF+lpi++A+  L +c+Tv+K+iCR+ G+ RWP+Rk
  EcC053395.20 261 KMTLADVGGYFHLPIEKASERLHLCPTVVKKICRKGGVGRWPYRK 305
                   7899****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.823247305IPR003035RWP-RK domain
PfamPF020425.8E-17261305IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006807Biological Processnitrogen compound metabolic process
GO:0016810Molecular Functionhydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MADPKAAAPG SESDDDLFGD DYLKYLLPNP DPGLEDDMPP LDLQLALKSD ENTPLPVDEI  60
GDPDPFDDPA VWHLFNRGHG DGNNGAGSSH AGPSGTSSGG TEDCYYSQPE DWNYSVPRVL  120
PNWPAPPLPY NCSCCQVLRE IIHTHVETNH TTKLELHGRV GMVSHAILDT QHNPGAVPSN  180
GEDRYQMFDF CKKSIQNVKD FLQQYCEGRR LAGYIMYQDP LAMFYEAVCV GIDFNGNVNA  240
DYFQLPLPPT VSGDARERAG KMTLADVGGY FHLPIEKASE RLHLCPTVVK KICRKGGVGR  300
WPYRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010050417.10.0PREDICTED: uncharacterized protein LOC104438976
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.13e-08Nin-like family protein